Table 1.

Integrative list of deformation-induced phosphorylations in the reticulocyte

Accession no.Gene symbolProtein nameSequenceCountSite
E9PIJ1AMPD2AMP deaminase 2TDSDSDLQLYK7*S190/S197
A0A0U1RQT1ACAP2Arf-GAP with coiled-coil, ANK repeat, and PH domain-containing protein 2SSPSTGSLDSGNESK7*S384
B7Z3I9ALADΔ-aminolevulinic acid dehydrataseSSPAFGDR7S215
P49840GSK3AGlycogen synthase kinase-3 αGEPNVSYICSR7*Y279
P49840GSK3AGlycogen synthase kinase-3 αTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGK7*S21/S39
E9PK89RAB3IL1Guanine nucleotide exchange factor for Rab-3ATLVITSTPASPNR7S168
B4DMA2HSP90AB1Heat shock protein HSP 90-βIEDVGSDEEDDSGKDK7*S255
Q9H1E3NUCKS1Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1VVDYSQFQESDDADEDYGR7*S19
S4R2Y4CBX3Chromobox protein homolog 3SLSDSESDDSK6S93
Q08495DMTNDematinDSSVPGSPSSIVAK6S26
Q9UG54MAP3K7Mitogen-activated protein kinase kinase kinase 7SIQDLTVTGTEPGQVSSR6S439
P61006RAB8ARas-related protein Rab-8AKLEGNSPQGSNQGVK6S181/S185
B3KVN0SLC2A1Solute carrier family 2, facilitated glucose transporter member 1TPEELFHPLGADSQV6S490
A0A087WYB4STOML2Stomatin-like protein 2, mitochondrialAPVPGTPDSLSSGSSR6T327
Q8IV54TSC22D4TSC22D4 proteinNGSPPPGAPSSR6S62
P16157ANK1Ankyrin-1NGASPNEVSSDGTTPLAIAK5S759
A0A0U1RQT1ACAP2Arf-GAP with coiled-coil, ANK repeat, and PH domain-containing protein 2YSISLSPPEQQK5S521
P27824CANXCalnexinQKSDAEEDGGTVSQEEEDR5S564
G3V238EEF1AKMT2EEF1A lysine methyltransferase 2SDKGSPGEDGFVPSALGTR5S21
P05198EIF2S1Eukaryotic translation initiation factor 2 subunit 1VVTDTDETELAR5T279
F8WAE5EIF2AEukaryotic translation initiation factor 2ASDKSPDLAPTPAPQSTPR5S506
C9JII4GCFC2GC-rich sequence DNA-binding factor 2ELPVPGSAEEEPPSGGGR5S40
Q2VPJ6HSP90AA1HSP90AA1 proteinDKEVSDDEAEEK5S231
D3DWY2IKBKGInhibitor of κ light polypeptide gene enhancer in B-cells, kinase γSPPEEPPDFCCPK5S387
O60307MAST3Microtubule-associated serine/threonine-protein kinase 3SSENVLDEEGGR5S134
F2Z2K0NSFL1CNSFL1 cofactor p47SPNELVDDLFK5S114
B7Z8Y1NFATC2Nuclear factor of activated T-cells, cytoplasmic 2TSPDPSPVSAAPSK5S330
H0Y5Q9INPP5DPhosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1GESPPTPPGQPPISPK5T963
D6RC77PGM3Phosphoacetylglucosamine mutaseSTIGVMVTASHNPEEDNGVK5S64
M4QHP2PIEZO1Piezo-type mechanosensitive ion channel componentSGSEEAVTDPGER5S1621
Q9BVG4PBDC1Protein PBDC1GADSGEEKEEGINR5S197
B4E3V2SQSTM1Sequestosome-1LTPVSPESSSTEEK5T269/S272
Q6PJD5SHARPINSHARPIN proteinSPGNLTER5S165
B2RMN7SPTBSpectrin β chainTSPVSLWSR5S2114/S2117
C9JWF0SMC4Structural maintenance of chromosomes protein 4REEGPPPPSPDGASSDAEPEPPSGR5S22
H0YN01TLN2Talin-2LDEGTPPEPK5T1843
C9J3F6TBC1D5TBC1 domain family member 5NISSSPSVESLPGGR5S541/S544
E9PJJ0TBCELTubulin-specific chaperone cofactor E-like proteinYSPENFPYR5S18
Q8IXQ3C9orf40Uncharacterized protein C9orf40RDSGDNSAPSGQER5S76
Q5JSH3WDR44WD repeat-containing protein 44VGNESPVQELK5S50
F8WBS8PSMD226S proteasome non-ATPase regulatory subunit 2DKAPVQPQQSPAAAPGGTDEKPSGK4S16
Q92625ANKS1AAnkyrin repeat and SAM domain-containing protein 1ASESLSNCSIGK4S647
E9PJP4EPB41L2Band 4.1-like protein 2EVAENQQNQSSDPEEEKGSQPPPAAESQSSLR4S39/S58
A8MZ77BSGBasiginRKPEDVLDDDDAGSAPLK4S362
Q9NSY1BMP2KBMP-2-inducible protein kinaseDSQSSNEFLTISDSK4S1029
A0A0C4DGD1CASTCalpastatinDTSQSDKDLDDALDK4S563
Q9Y5K6CD2APCD2-associated proteinKNSLDELR4S582
Q8TEH3DENND1ADENN domain-containing protein 1ATGGTLSDPEVQR4T24
B4DU91EPN1Epsin-1SPGAFDMSGVR4S435
M0QXW7KHSRPFar upstream element-binding protein 2VQISPDSGGLPER4S181
F5H1C6FERMT3Fermitin family homolog 3TASGDYIDSSWELR4Y11
P04075ALDOAFructose-bisphosphate aldolase AGILAADESTGSIAKR4S36
H0YJ30GPHNGephyrinASHSAVDITK4S303/S305
Q2Q9B7G6PDGlucose-6-phosphate 1-dehydrogenaseVQPNEAVYTK4Y401
E9PK89RAB3IL1Guanine nucleotide exchange factor for Rab-3AELHPQLLSPTK4S179
O75633GNASGuanine nucleotide-binding protein Gs α subunit isoform L3ISTASGDGR4S352
Q5H924HUWE1HECT, UBA, and WWE domain containing 1REESPMDVDQPSPSAQDTQSIASDGTPQGEK4S3816
A0A0F7NGI8LRRFIP1Leucine rich repeatIDGATQSSPAEPK4S714
E9PJF4CLNS1AMethylosome subunit pIClnEPVADEEEEDSDDDVEPITEFR4S102
S4R3D6APIPMethylthioribulose-1-phosphate dehydrataseDISGPSPSKK4S87
Q6NT16SLC18B1MFS-type transporter SLC18B1SKSQNILSTEEER4S438
B4DS42OATL1Ornithine aminotransferase-like 1QASLDGLQQLR4S506
P30041PRDX6Peroxiredoxin-6DFTPVCTTELGR4T44
I3L1U0RILPRab-interacting lysosomal proteinAESSEDETSSPAPSK4S354
Q9P227ARHGAP23ρ GTPase-activating protein 23SAEALGPGALVSPR4S361/S372
Q16513PKN2Serine/threonine-protein kinase N2ASSLGEIDESSELR4S583
C9JIG9OXSR1Serine/threonine-protein kinase OSR1TEDGGWEWSDDEFDEESEEGK4S339
P02549SPTA1Spectrin α chain, erythrocytic 1QDTLDASLQSFQQER4S1976
B2RMN7SPTBSpectrin β chainLSSSWESLQPEPSHPY4S2123/S2125/S2128
B4DZC9SLKSTE20-like serine/threonine-protein kinaseVDEDSAEDTQSNDGK4S571
P17987TCP1T-complex protein 1 subunit αHGSYEDAVHSGALND4S544/Y545
B4DUI5TPI1Triosephosphate isomeraseIIYGGSVTGATCK4Y246
Q8IV54TSC22D4TSC22D4 proteinVEAEAGGSGARTPPLSR4T229
B4DQ79LYNTyrosine-protein kinaseVIEDNEYTAR4Y397
A0A024R8I2UBADC1Ubiquitin associated domain containing 1, isoform CRA_cAPSPLPK4S98
Q5VVQ6YOD1Ubiquitin thioesterase OTU1SSPAFTK4S130
B3KW31VPS13AVacuolar protein sorting 13AQASFTDVRDPSLK4S1416
A0A0S2Z3K9CRKV-crk sarcoma virus CT10 oncogene-like protein isoform 2DSSTSPGDYVLSVSENSR4S41
  • List of significantly enriched or exclusive phosphopeptides in reticulocytes after deformation, as assayed through microsphiltration and microcapillary traversal. Generally, only phosphopeptides present in at least 4 of the 7 postdeformation samples (4 microsphiltration + 3 microfluidics) and not present in at least 4 of the 7 predeformation samples were included. The exception to this analysis consists of the phosphopeptides counted as 7*, which were present in all postdeformation samples but also in 4 of 7 of the predeformation samples. The prediction of the most probable phosphosites in the phosphopeptide was included according to the count of occurrences in previous low-throughput and high-throughput studies, as assayed through PhosphoSitePlus.50